PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10020714m
Common NameCARUB_v10020714mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 302aa    MW: 34222.1 Da    PI: 6.3128
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10020714mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  Carubv10020714m 15 KGLWSPEEDEKLLNYITKHGHGSWSSVPKLAGLQRCGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding46.31e-1468111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ eE++l+v++++ lG++ W+ Ia++++ gRt++++k+ w++
  Carubv10020714m  68 RGAFSSEEQDLIVELHAVLGNR-WSQIAARLP-GRTDNEIKNLWNS 111
                      89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-27765IPR009057Homeodomain-like
PROSITE profilePS5129425.1881066IPR017930Myb domain
SuperFamilySSF466892.62E-3013109IPR009057Homeodomain-like
SMARTSM007175.6E-131464IPR001005SANT/Myb domain
PfamPF002491.5E-161562IPR001005SANT/Myb domain
CDDcd001672.80E-111862No hitNo description
Gene3DG3DSA:1.10.10.609.4E-2566117IPR009057Homeodomain-like
PROSITE profilePS5129419.75467117IPR017930Myb domain
SMARTSM007175.5E-1267115IPR001005SANT/Myb domain
PfamPF002493.4E-1368111IPR001005SANT/Myb domain
CDDcd001671.72E-870110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MKRSHSCCYK QKLRKGLWSP EEDEKLLNYI TKHGHGSWSS VPKLAGLQRC GKSCRLRWIN  60
YLRPDLKRGA FSSEEQDLIV ELHAVLGNRW SQIAARLPGR TDNEIKNLWN SCIKKKLRQK  120
GIDPITHKPL SEVDGDTNIS FNHSSTSFSS ESNQDFFVKE PSDFSDYLAF QKQDTNSVSQ  180
SSMIDGSSVS ISGFETQSYV KSSIPPRDNT SSTISGEDHV QVIEPTWESN FGTTSHLDNP  240
SLEEMKWSEE YLNESLFLNP VYVKSETDFD SNIAFPWSQS QACDVIPKDL QRMVFSFGQT  300
L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5503041e-160AY550304.1 Arabidopsis thaliana MYB transcription factor (At1g57557) mRNA, complete cds.
GenBankBT0292251e-160BT029225.1 Arabidopsis thaliana At1g57560 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302609.10.0hypothetical protein CARUB_v10020714mg
TrEMBLR0GI250.0R0GI25_9BRAS; Uncharacterized protein
STRINGAT1G57560.11e-177(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.11e-161myb domain protein 50